cai

 

Function

CAI codon adaptation index

Description

cai calculates the Codon Adaptation Index. This is a simple, effective measure of synonymous codon usage bias.

The index uses a reference set of highly expressed genes from a species to assess the relative merits of each codon, and a score for a gene is calculated from the frequency of use of all codons in that gene. The index assesses the extent to which selection has been effective in moulding the pattern of codon usage. In that respect it is useful for predicting the level of expression of a gene, for assessing the adaptation of viral genes to their hosts, and for making comparisons of codon usage in different organisms. The index may also give an approximate indication of the likely success of heterologous gene expression.

Usage

Here is a sample session with cai


% cai TEMBL:AB009602 
CAI codon adaptation index
Codon usage file [Eyeastcai.cut]: 
Output file [ab009602.cai]: 

Go to the input files for this example
Go to the output files for this example

Command line arguments

   Mandatory qualifiers:
  [-seqall]            seqall     Sequence database USA
   -cfile              codon      Codon usage file
  [-outfile]           outfile    Output file name

   Optional qualifiers: (none)
   Advanced qualifiers: (none)
   General qualifiers:
  -help                boolean    Report command line options. More
                                  information on associated and general
                                  qualifiers can be found with -help -verbose


Mandatory qualifiers Allowed values Default
[-seqall]
(Parameter 1)
Sequence database USA Readable sequence(s) Required
-cfile Codon usage file Codon usage file in EMBOSS data path Eyeastcai.cut
[-outfile]
(Parameter 2)
Output file name Output file <sequence>.cai
Optional qualifiers Allowed values Default
(none)
Advanced qualifiers Allowed values Default
(none)

Input file format

cai reads a nucleic acid sequence of a gene.

Input files for usage example

Database entry: TEMBL:AB009602

ID   AB009602   standard; RNA; FUN; 561 BP.
XX
AC   AB009602;
XX
SV   AB009602.1
XX
DT   15-DEC-1997 (Rel. 53, Created)
DT   15-DEC-1997 (Rel. 53, Last updated, Version 1)
XX
DE   Schizosaccharomyces pombe mRNA for MET1 homolog, partial cds.
XX
KW   MET1 homolog.
XX
OS   Schizosaccharomyces pombe (fission yeast)
OC   Eukaryota; Fungi; Ascomycota; Schizosaccharomycetes;
OC   Schizosaccharomycetales; Schizosaccharomycetaceae; Schizosaccharomyces.
XX
RN   [1]
RP   1-561
RA   Kawamukai M.;
RT   ;
RL   Submitted (07-DEC-1997) to the EMBL/GenBank/DDBJ databases.
RL   Makoto Kawamukai, Shimane University, Life and Environmental Science; 1060
RL   Nishikawatsu, Matsue, Shimane 690, Japan
RL   (E-mail:kawamuka@life.shimane-u.ac.jp, Tel:0852-32-6587, Fax:0852-32-6499)
XX
RN   [2]
RP   1-561
RA   Kawamukai M.;
RT   "S.pmbe MET1 homolog";
RL   Unpublished.
XX
DR   SPTREMBL; Q9URL1; Q9URL1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..561
FT                   /db_xref="taxon:4896"
FT                   /sequenced_mol="cDNA to mRNA"
FT                   /organism="Schizosaccharomyces pombe"
FT                   /clone_lib="pGAD GH"
FT   CDS             <1..275
FT                   /codon_start=3
FT                   /db_xref="SPTREMBL:Q9URL1"
FT                   /transl_table=1
FT                   /product="MET1 homolog"
FT                   /protein_id="BAA23999.1"
FT                   /translation="SMPKIPSFVPTQTTVFLMALHRLEILVQALIESGWPRVLPVCIAE
FT                   RVSCPDQRFIFSTLEDVVEEYNKYESLPPGLLITGYSCNTLRNTA"
XX
SQ   Sequence 561 BP; 135 A; 106 C; 98 G; 222 T; 0 other;
     gttcgatgcc taaaatacct tcttttgtcc ctacacagac cacagttttc ctaatggctt        60
     tacaccgact agaaattctt gtgcaagcac taattgaaag cggttggcct agagtgttac       120
     cggtttgtat agctgagcgc gtctcttgcc ctgatcaaag gttcattttc tctactttgg       180
     aagacgttgt ggaagaatac aacaagtacg agtctctccc ccctggtttg ctgattactg       240
     gatacagttg taataccctt cgcaacaccg cgtaactatc tatatgaatt attttccctt       300
     tattatatgt agtaggttcg tctttaatct tcctttagca agtcttttac tgttttcgac       360
     ctcaatgttc atgttcttag gttgttttgg ataatatgcg gtcagtttaa tcttcgttgt       420
     ttcttcttaa aatatttatt catggtttaa tttttggttt gtacttgttc aggggccagt       480
     tcattattta ctctgtttgt atacagcagt tcttttattt ttagtatgat tttaatttaa       540
     aacaattcta atggtcaaaa a                                                 561
//

Output file format

cai writes the Codon Adaptation Index to the output file.

Output files for usage example

File: ab009602.cai

Sequence: AB009602 CAI: 0.188

Data files

cai reads a reference codon usage table prepared from a set of genes which are known to be highly expressed.

The default codon usage table 'Eyeastcai.cut' was prepared from a set of S. pombe genes by Peter Rice.

You should prepare your own codon usage table for your organism of interest.

EMBOSS data files are distributed with the application and stored in the standard EMBOSS data directory, which is defined by the EMBOSS environment variable EMBOSS_DATA.

To see the available EMBOSS data files, run:

% embossdata -showall

To fetch one of the data files (for example 'Exxx.dat') into your current directory for you to inspect or modify, run:


% embossdata -fetch -file Exxx.dat

Users can provide their own data files in their own directories. Project specific files can be put in the current directory, or for tidier directory listings in a subdirectory called ".embossdata". Files for all EMBOSS runs can be put in the user's home directory, or again in a subdirectory called ".embossdata".

The directories are searched in the following order:

Notes

None.

References

Sharp PM., Li W-H. "The codon adaptation index - a measure of directional synonymous codon usage bias, and its potential applications." Nucleic Acids Research 1987 vol 15, pp 1281-1295.

Warnings

None.

Diagnostic Error Messages

None.

Exit status

It always exits with status 0.

Known bugs

None.

See also

Program nameDescription
chipsCodon usage statistics
codcmpCodon usage table comparison
cuspCreate a codon usage table
sycoSynonymous codon usage Gribskov statistic plot

Author(s)

This application was written by Alan Bleasby (ableasby@hgmp.mrc.ac.uk)

History

Written (March 2001) - Alan Bleasby.

Target users

This program is intended to be used by everyone and everything, from naive users to embedded scripts.

Comments